Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis ATP synthase subunit a(mt-atp6)

Recombinant Xenopus laevis ATP synthase subunit a(mt-atp6)

SKU:CSB-CF015070XBE

Regular price $1,903.00 USD
Regular price Sale price $1,903.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:P00849

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNLSFFDQFMSPVILGIPLIAIAMLDPFTLISWPIQSNGFNNRLITLQSWFLHNFTTIFY QLTSPGHKWALLLTSLMLLLMSLNLLGLLPYTFTPTTQLSLNMGLAVPLWLATVIMASKP TNYALGHLLPEGTPTPLIPVLIIIETISLFIRPLALGVRLTANLTAGHLLIQLIATAAFV LLSIMPTVAILTSIVLFLLTLLEIAVAMIQAYVFVLLLSLYLQENV

Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): F-ATPase protein 6

Gene Names:Name:mt-atp6 Synonyms:atp6, atpase6, mtatp6

Expression Region:1-226

Sequence Info:full length protein

View full details