Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xenopus laevis 3-hydroxyacyl-CoA dehydratase(ptplad2)

Recombinant Xenopus laevis 3-hydroxyacyl-CoA dehydratase(ptplad2)

SKU:CSB-CF753567XBE

Regular price $1,892.00 USD
Regular price Sale price $1,892.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Xenopus laevis (African clawed frog)

Uniprot NO.:Q6GNB5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKTYLSIYYLIQFCGHSWIFTNMTTRFLFFGQDAFADTFYSIGLVMQGCQLLSILELAHI LLGVEQNGFLPMFLQVAERFIILFVVITSQEEVQSKYIVCALFFIWNLWDVIRYPYDMLA AVDTDYSALTWLRHTWWIVAYPLSVLAEAYTIYESLPYFESLGTYSFKMALPVSLSFHFP YILTLYLVLQPVGMLYICSCLWSERKQYFQRKLKLKKN

Protein Names:Recommended name: 3-hydroxyacyl-CoA dehydratase Short name= HACD EC= 4.2.1.- Alternative name(s): Protein tyrosine phosphatase-like protein ptplad2 Protein-tyrosine phosphatase-like A domain-containing protein 2

Gene Names:Name:ptplad2 Synonyms:hacd

Expression Region:1-218

Sequence Info:full length protein

View full details