Gene Bio Systems
Recombinant Xanthomonas campestris pv. campestris Sulfoxide reductase heme-binding subunit YedZ(yedZ)
Recombinant Xanthomonas campestris pv. campestris Sulfoxide reductase heme-binding subunit YedZ(yedZ)
SKU:CSB-CF847920XAY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Xanthomonas campestris pv. campestris (strain ATCC 33913 / NCPPB 528 / LMG 568)
Uniprot NO.:Q8PA99
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAKKSVSVIAAKTAVHAAVLAPIALLGWQFWQVWQQGSDALGADPVAEIEHRTGLWALRL LLITLAITPLRQLTGQAVLIRFRRMLGLYAFFYASVHLTAYLWLDLRGFWTQIFEEIVKR PYITVGFTAWLLLVPLAITSTQGWMRRLKRNWGRLHMLIYPIGLLAVLHFWWLVKSDIRE PALYAGILALLLGWRVWKRLSARRTTARHSAPPPATPR
Protein Names:Recommended name: Sulfoxide reductase heme-binding subunit YedZ Alternative name(s): Flavocytochrome YedZ
Gene Names:Name:yedZ Ordered Locus Names:XCC1587
Expression Region:1-218
Sequence Info:full length protein
