Skip to product information
1 of 1

Gene Bio Systems

Recombinant Xanthobacter autotrophicus UPF0060 membrane protein Xaut_1380 (Xaut_1380)

Recombinant Xanthobacter autotrophicus UPF0060 membrane protein Xaut_1380 (Xaut_1380)

SKU:CSB-CF416343XAV

Regular price $1,690.00 USD
Regular price Sale price $1,690.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

Uniprot NO.:A7IF35

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MTLPAFLFAALGEIAGCFAVWHVVRLGGSHWWLLPGIVSLAAFAYALTFVEAEAAGRAFA AYGGIYILSSLVWMWTVEGVRPDRWDATGAALCLAGAAVIVFGPRG

Protein Names:Recommended name: UPF0060 membrane protein Xaut_1380

Gene Names:Ordered Locus Names:Xaut_1380

Expression Region:1-106

Sequence Info:full length protein

View full details