Gene Bio Systems
Recombinant Wheat dwarf virus Movement protein (V2)
Recombinant Wheat dwarf virus Movement protein (V2)
SKU:CSB-CF361967WAH
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Wheat dwarf virus (isolate Sweden) (WDV)
Uniprot NO.:P06849
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEQAIAPPLPIRDYQYQTPSIPGSSDYAWRTFVFVTFGLLIAVGVAWLAYTLFLKDLILV CKAKKQRRTEEIGYGNTPARLNGDQQGLPR
Protein Names:Recommended name: Movement protein Short name= MP
Gene Names:ORF Names:V2
Expression Region:1-90
Sequence Info:full length protein
