Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vitis vinifera CASP-like protein VIT_07s0104g01350 (VIT_07s0104g01350)

Recombinant Vitis vinifera CASP-like protein VIT_07s0104g01350 (VIT_07s0104g01350)

SKU:CSB-CF417839VFQ

Regular price $1,806.00 USD
Regular price Sale price $1,806.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Vitis vinifera (Grape)

Uniprot NO.:A7PTY8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MESQCRPNVDGVHNGVESHVKVVEKPRSVGSSSEFVLRILGLLLTLIAAVVAGVDKQTKI IPLTLIKTLPSLHVPVTAKWSDMSAFVYLVVSNAIACSYAAISLVLVTMLGRRGKGGRVL AVIVLDLHMVGLLFSANGAATAVGVLGQYGNSHVEWKKVCNVFDSFCHHLVASLALSFLG SLSFLGLVLLAILNLHKKSSTK

Protein Names:Recommended name: CASP-like protein VIT_07s0104g01350

Gene Names:Ordered Locus Names:VIT_07s0104g01350 ORF Names:GSVIVT00023588001, GSVIVT01010992001, VIT_00010992001, VITISV_023954, Vv07s0104g01350

Expression Region:1-202

Sequence Info:full length protein

View full details