Gene Bio Systems
Recombinant Vibrio vulnificus Na(+)-translocating NADH-quinone reductase subunit E(nqrE)
Recombinant Vibrio vulnificus Na(+)-translocating NADH-quinone reductase subunit E(nqrE)
SKU:CSB-CF745434VCQ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Vibrio vulnificus (strain YJ016)
Uniprot NO.:Q7MID1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MEHYISLLIKSIFIENMALSFFLGMCTFLAVSKKVKTSFGLGVAVVVVLTIAVPVNNLVY NLVLKENALVEGVDLSFLNFITFIGVIAALVQILEMILDRFFPPLYNALGIFLPLITVNC AIFGGVSFMVQRDYNFAESVVYGFGAGVGWMLAIVALAGIREKMKYSDVPPGLRGLGITF ITVGLMALGFMSFSGVQL
Protein Names:Recommended name: Na(+)-translocating NADH-quinone reductase subunit E Short name= Na(+)-NQR subunit E Short name= Na(+)-translocating NQR subunit E EC= 1.6.5.- Alternative name(s): NQR complex subunit E NQR-1 subunit E
Gene Names:Name:nqrE Ordered Locus Names:VV2586
Expression Region:1-198
Sequence Info:full length protein
