Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Vibrio splendidus (strain LGP32) (Vibrio splendidus (strain Mel32))
Uniprot NO.:B7VHB5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MISGDTILFALMVVTCVNWARYFTALRTLIYIMREAHPLLYQQVDGGGFFTTHGNMTKQV RLFSYIKSKEYHHHHDEVFTSKCDRVRQLFILSSALLGVTLLSSFIV
Protein Names:Recommended name: Universal stress protein B homolog
Gene Names:Name:uspB Ordered Locus Names:VS_0092
Expression Region:1-107
Sequence Info:full length protein