Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vibrio splendidus Probable intracellular septation protein A (VS_1149)

Recombinant Vibrio splendidus Probable intracellular septation protein A (VS_1149)

SKU:CSB-CF490229VFH

Regular price $1,812.00 USD
Regular price Sale price $1,812.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Vibrio splendidus (strain LGP32) (Vibrio splendidus (strain Mel32))

Uniprot NO.:B7VMM4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKQILDFIPLIIFFALYKMYDIYTATGALIVASAVQIILTYFIYKKVEKMQVITFLMVAV FGGMTIFLHDDNFIKWKVTIVYALFAIGLTVSHIMGKSAIKGMLGKEITLPDSIWGKINW AWTLFFTLCAILNVYVAFNLPLDVWVNFKVFGLLIATFAFTLLTGVYIYKHLPKDQHLPK DKHQQRDQETQNDTQQELSGKNTEEK

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:VS_1149

Expression Region:1-206

Sequence Info:full length protein

View full details