Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vibrio harveyi Fumarate reductase subunit D(frdD)

Recombinant Vibrio harveyi Fumarate reductase subunit D(frdD)

SKU:CSB-CF416488VEA

Regular price $1,710.00 USD
Regular price Sale price $1,710.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Vibrio harveyi (strain ATCC BAA-1116 / BB120)

Uniprot NO.:A7MZ44

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKPNYSVNTAPKRSDEPIWWGLFGAGGTWFAMITPITVLVLGILVPLGVIDAEAMSYERV SEFATSIIGALFIIGTLALPMWHAMHRVHHGMHDLKFHTGVVGKIACYAFAGLISALAVV FIFMI

Protein Names:Recommended name: Fumarate reductase subunit D

Gene Names:Name:frdD Ordered Locus Names:VIBHAR_00134

Expression Region:1-125

Sequence Info:full length protein

View full details