Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Vibrio cholerae serotype O1 (strain ATCC 39541 / Ogawa 395 / O395)
Uniprot NO.:A5F4E9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MISGDTILFALMLVTAINVARYVTALRSLIYIMREAHPLLYQQVDGRGFFTTHGNVTKQV RLYHYLKSREYHHHHDPVFTGKCDRVRELFILSGSLLVLTTVVAFML
Protein Names:Recommended name: Universal stress protein B homolog
Gene Names:Name:uspB Ordered Locus Names:VC0395_A2436, VC395_0101
Expression Region:1-107
Sequence Info:full length protein