Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vibrio cholerae serotype O1 Probable D-methionine transport system permease protein metI(metI)

Recombinant Vibrio cholerae serotype O1 Probable D-methionine transport system permease protein metI(metI)

SKU:CSB-CF878389VEX-GB

Regular price $1,834.00 USD
Regular price Sale price $1,834.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

Uniprot NO.:Q9KTJ6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSFNTIAQWFALNSDLLLTATWQTLYMVAIAGAVGFALGIPLGVILHTTKKEGLLENLPL NRALGAVVNIGRSVPFLVLMVAIIPVTKLIVGTFIGTTAAIVPLTIGAIPFVARLIESAL LEVPTGLVEAAQSMGATPLQIIRKVLLPEALPTILNSVTITLVTLVSYSAMAGTVGGGGL GDVAIRYGFHRYDITIMAVTVVMLIVLVQIIQSIGDALVRRVDHR

Protein Names:Recommended name: Probable D-methionine transport system permease protein metI

Gene Names:Name:metI Ordered Locus Names:VC_0906

Expression Region:1-225

Sequence Info:full length protein

View full details