Recombinant Vibrio cholerae serotype O1  Fumarate reductase subunit D(frdD)

Recombinant Vibrio cholerae serotype O1 Fumarate reductase subunit D(frdD)

CSB-CF881585VEX
Regular price
$1,088.00 USD
Sale price
$1,088.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

Uniprot NO.:Q9KNS2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFLLWCKELIVINTNPKRSDEPVWWSLFGAGGTWFAMITPITVLVLGILAPLGVIDAEAL SYERVSSFATSIIGALFIIGTLALPMWHAMHRVHHGMHDLKFHTGVAGKIACYGFATIIS ALAVVFIFMI

Protein Names:Recommended name: Fumarate reductase subunit D

Gene Names:Name:frdD Ordered Locus Names:VC_2659

Expression Region:1-130

Sequence Info:full length protein