Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Vibrio cholerae serotype O1 (strain M66-2)
Uniprot NO.:C3LS87
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSNRKPYVREMKRTWWKDHPFYRFYMVREATVLPLILFTLFLTVGLGSLVKGPEAWQTWL DFMANPLVIAINLVALAGSLFHAQTFFSMMPQVVPIRLGGKLVDKKIIVLAQWAAVAFIS LIVLIVV
Protein Names:Recommended name: Fumarate reductase subunit C
Gene Names:Name:frdC Ordered Locus Names:VCM66_2578
Expression Region:1-127
Sequence Info:full length protein