Gene Bio Systems
Recombinant Vibrio cholerae serotype O1 Accessory cholera enterotoxin(ace)
Recombinant Vibrio cholerae serotype O1 Accessory cholera enterotoxin(ace)
SKU:CSB-CF330882VEX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
Uniprot NO.:P38441
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLMMDTLYDWLIDGFTWLVIKLGIMWIESKIFVIQFFWEMSQKVIDMFTIYPLIQQAIDM LPPQYSGFLFFLGLDQALAIVLQALMTRFALRALNL
Protein Names:Recommended name: Accessory cholera enterotoxin Short name= Ace
Gene Names:Name:ace Ordered Locus Names:VC_1459
Expression Region:1-96
Sequence Info:full length protein
