Gene Bio Systems
Recombinant Variola virus Protein J5 (J5L, L5L)
Recombinant Variola virus Protein J5 (J5L, L5L)
SKU:CSB-CF329224VAR
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Variola virus (isolate Human/India/Ind3/1967) (VARV) (Smallpox virus)
Uniprot NO.:P33055
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTDEQIYAFCDANKDDIRCKCIYPDKSIVRIGIDTRLPYYCWYEPCKRSDALLPASLKKN ISRCNVSDCTISLGNVSITDSKLDVNNVCDSKRVATENIAVRYLNQEIRYPIIDIKWLPI GLLALAILILAFF
Protein Names:Recommended name: Protein J5
Gene Names:ORF Names:J5L, L5L
Expression Region:1-133
Sequence Info:full length protein
