Skip to product information
1 of 1

Gene Bio Systems

Recombinant Varicella-zoster virus Membrane protein 0(ORF0)

Recombinant Varicella-zoster virus Membrane protein 0(ORF0)

SKU:CSB-CF739637VAP

Regular price $1,753.00 USD
Regular price Sale price $1,753.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Varicella-zoster virus (strain Dumas) (HHV-3) (Human herpesvirus 3)

Uniprot NO.:Q6F6K2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MATVHYSRRPGTPPVTLTSSPSMDDVATPIPYLPTYAEAVADAPPPYRSRESLVFSPPLF PHVENGTTQQSYDCLDCAYDGIHRLQLAFLRIRKCCVPAFLILFGILTLTAVVVAIVAVF PEEPPNSTT

Protein Names:Recommended name: Membrane protein 0 Alternative name(s): Membrane ORF0 protein ORF S/L

Gene Names:ORF Names:ORF0

Expression Region:1-129

Sequence Info:full length protein

View full details