Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vanderwaltozyma polyspora NADH-cytochrome b5 reductase 1(CBR1)

Recombinant Vanderwaltozyma polyspora NADH-cytochrome b5 reductase 1(CBR1)

SKU:CSB-CF006318VDW

Regular price $1,965.00 USD
Regular price Sale price $1,965.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) (Kluyveromyces polysporus)

Uniprot NO.:A7TNL7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAESMNKIFIAIIAIAVAAAATKMFTSEEPKSKALPVLVKGEYMQFPLVSIKKLNRNSAIYRFKLPTDEHVLGLPIGQHITIKAHIDGSEVVRSYTPISLDSEAKGYFELLIKSYEQGKISKMFTSLKIGDTIDVQGPKGFYEYTDRSSKHLAMIAGGSGLTPMYQIIKSIAENPKDKTKVTFIYGNVEEIDILLRDDLDKFAASKPGQITIHYLLDKPSENWKGGSGYVTPELMKEKLPAPADGVQLLVCGPLPMVSAIKRSAVALGFPKAKPVSKMNDQVFVF

Protein Names:Recommended name: NADH-cytochrome b5 reductase 1 EC= 1.6.2.2 Alternative name(s): Microsomal cytochrome b reductase

Gene Names:Name:CBR1 ORF Names:Kpol_1070p17

Expression Region:1-285

Sequence Info:full length protein

View full details