Skip to product information
1 of 1

Gene Bio Systems

Recombinant Vaccinia virus Viral replication protein A28 (VACWR151)

Recombinant Vaccinia virus Viral replication protein A28 (VACWR151)

SKU:CSB-CF300757VAI

Regular price $1,788.00 USD
Regular price Sale price $1,788.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))

Uniprot NO.:P68633

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNSLSIFFIVVATAAVCLLFIQGYSIYENYGNIKEFNATHAAFEYSKSIGGTPALDRRVQDVNDTISDVKQKWRCVVYPGNGFVSASIFGFQAEVGPNNTRSIRKFNTMQQCIDFTFSDVININIYNPCVVPNINNAECQFLKSVL

Protein Names:Recommended name: Viral replication protein A28

Gene Names:Ordered Locus Names:VACWR151 ORF Names:A28L

Expression Region:1-146

Sequence Info:full length protein

View full details