Recombinant Vaccinia virus  Protein L5 (VACWR092)

Recombinant Vaccinia virus Protein L5 (VACWR092)

CSB-CF302387VAI
Regular price
$1,097.00 USD
Sale price
$1,097.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))

Uniprot NO.:P68623

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MENVPNVYFNPVFIEPTFKHSLLSVYKHRLIVLFEVFVVFILIYVFFRSELNMFFMPKRK IPDPIDRLRRANLACEDDKLMIYGLPWMTTQTSALSINSKPIVYKDCAKLLRSINGSQPV SLNDVLRR

Protein Names:Recommended name: Protein L5 Alternative name(s): Protein F6

Gene Names:Ordered Locus Names:VACWR092 ORF Names:L5R

Expression Region:1-128

Sequence Info:full length protein

Your list is ready to share