
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR))
Uniprot NO.:P68623
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MENVPNVYFNPVFIEPTFKHSLLSVYKHRLIVLFEVFVVFILIYVFFRSELNMFFMPKRK IPDPIDRLRRANLACEDDKLMIYGLPWMTTQTSALSINSKPIVYKDCAKLLRSINGSQPV SLNDVLRR
Protein Names:Recommended name: Protein L5 Alternative name(s): Protein F6
Gene Names:Ordered Locus Names:VACWR092 ORF Names:L5R
Expression Region:1-128
Sequence Info:full length protein