Gene Bio Systems
Recombinant V-type proton ATPase 16 kDa proteolipid subunit 1(vha-1)
Recombinant V-type proton ATPase 16 kDa proteolipid subunit 1(vha-1)
SKU:CSB-CF637438CXY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Caenorhabditis elegans
Uniprot NO.:Q21898
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSTDTKQIIADALLKNEQAMYGPFFGSLGVTSAMAFAAAGSAYGTAKAGTGIASMAVARP DLVMKAIIPVVMAGIVAIYGLVVAVIVSGKVEPAGANYTINNAFSQFAGGLVCGLCGLGA GYAIGIAGDAGVRALSQQPRMFVGMILILIFAEVLGLYGMIVALILGAT
Protein Names:Recommended name: V-type proton ATPase 16 kDa proteolipid subunit 1 Short name= V-ATPase 16 kDa proteolipid subunit 1 Alternative name(s): Vacuolar proton pump 16 kDa proteolipid subunit 1
Gene Names:Name:vha-1 ORF Names:R10E11.8
Expression Region:1-169
Sequence Info:full length protein
