Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ustilago maydis Protein SYM1(SYM1)

Recombinant Ustilago maydis Protein SYM1(SYM1)

SKU:CSB-CF680864UBS

Regular price $1,801.00 USD
Regular price Sale price $1,801.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Ustilago maydis (strain 521 / FGSC 9021) (Smut fungus)

Uniprot NO.:Q4P9K6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSTFTRLIAATSSTFPRQCLTGGVLFATGDTIAQQLVEKRGSRHDLARTFRLSLYGGCVF SPLASIWFGRVLERVRFSSKAANIATKVALDQAIASPAFVALFFGATTIMEGGSPDQAKN KIIHNWWPTLKTAWGLWIPVQTLNMALVPPSQRLLFVNVVSIFWNTFLSIKSAAASDHAV KPNLNDAVELVETKLDKLH

Protein Names:Recommended name: Protein SYM1

Gene Names:Name:SYM1 ORF Names:UM03207

Expression Region:1-199

Sequence Info:full length protein

View full details