Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ustilago maydis Mitochondrial intermembrane space import and assembly protein 40(MIA40)

Recombinant Ustilago maydis Mitochondrial intermembrane space import and assembly protein 40(MIA40)

SKU:CSB-CF700030UBS

Regular price $1,827.00 USD
Regular price Sale price $1,827.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ustilago maydis (strain 521 / FGSC 9021) (Smut fungus)

Uniprot NO.:Q4P8D2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:VATKAAAGPSRQSALSSYSIAAVTAIGVGASFYALQSRSSAIQCEPRQAWHDRLKPKEAK GDATLHKDAHTRHAPAEVQDERVEPVEETPVAIEVAVEESEEQTGQQSAYDPETGEINWD CPCLGGMAHGPCGEQFKLAFSCFVYSEAEPKGIDCVDKFKAMQDCFREHPDVYKDEIEDD EAANAQFEKEEANAKSNGLNDAAQEAVEESSGGKEGASA

Protein Names:Recommended name: Mitochondrial intermembrane space import and assembly protein 40 Alternative name(s): Mitochondrial import inner membrane translocase TIM40

Gene Names:Name:MIA40 Synonyms:TIM40 ORF Names:UM03631

Expression Region:29-247

Sequence Info:full length protein

View full details