Recombinant Ureaplasma urealyticum serovar 10  ATP synthase subunit c(atpE)

Recombinant Ureaplasma urealyticum serovar 10 ATP synthase subunit c(atpE)

CSB-CF466884UBL
Regular price
$1,091.00 USD
Sale price
$1,091.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western)

Uniprot NO.:B5ZAW9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSFIDITNVISSHVEANLPAVSAENVQSLANGAGIAYLGKYIGTGITMLAAGAVGLMQG FSTANAVQAVARNPEAQPKILSTMIVGLALAEAVAIYALIVSILIIFVA

Protein Names:Recommended name: ATP synthase subunit c Alternative name(s): ATP synthase F(0) sector subunit c F-type ATPase subunit c Short name= F-ATPase subunit c Lipid-binding protein

Gene Names:Name:atpE Ordered Locus Names:UUR10_0152

Expression Region:1-109

Sequence Info:full length protein