Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ureaplasma parvum serovar 3 Putative phosphotransferase enzyme IIB component UU178(UU178)

Recombinant Ureaplasma parvum serovar 3 Putative phosphotransferase enzyme IIB component UU178(UU178)

SKU:CSB-CF879342UAO

Regular price $1,714.00 USD
Regular price Sale price $1,714.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ureaplasma parvum serovar 3 (strain ATCC 700970)

Uniprot NO.:Q9PQW5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MQNLNNKQKTLIIFLGIITFGIFIIYFFTKAKKVSQIRNTHLIVSSNIPFSLNDFYNCIG SKNNLVNVDATINTLKIELKEINALNNEKLKVLGAKGIMCNQTKISIIFGDFCLELKELI KKDLFS

Protein Names:Recommended name: Putative phosphotransferase enzyme IIB component UU178 EC= 2.7.1.69 Alternative name(s): Putative PTS system EIIB component

Gene Names:Ordered Locus Names:UU178

Expression Region:1-126

Sequence Info:full length protein

View full details