Gene Bio Systems
Recombinant Ureaplasma parvum serovar 3 Putative phosphotransferase enzyme IIB component UU178(UU178)
Recombinant Ureaplasma parvum serovar 3 Putative phosphotransferase enzyme IIB component UU178(UU178)
SKU:CSB-CF879342UAO
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Ureaplasma parvum serovar 3 (strain ATCC 700970)
Uniprot NO.:Q9PQW5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MQNLNNKQKTLIIFLGIITFGIFIIYFFTKAKKVSQIRNTHLIVSSNIPFSLNDFYNCIG SKNNLVNVDATINTLKIELKEINALNNEKLKVLGAKGIMCNQTKISIIFGDFCLELKELI KKDLFS
Protein Names:Recommended name: Putative phosphotransferase enzyme IIB component UU178 EC= 2.7.1.69 Alternative name(s): Putative PTS system EIIB component
Gene Names:Ordered Locus Names:UU178
Expression Region:1-126
Sequence Info:full length protein
