Skip to product information
1 of 1

Gene Bio Systems

Recombinant UPF0397 protein BA_2640-GBAA_2640-BAS2460(BA_2640, GBAA_2640, BAS2460)

Recombinant UPF0397 protein BA_2640-GBAA_2640-BAS2460(BA_2640, GBAA_2640, BAS2460)

SKU:CSB-CF770649BQE

Regular price $1,782.00 USD
Regular price Sale price $1,782.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus anthracis

Uniprot NO.:Q81PZ9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNRLSTKLVVAIGIGSALYGILGLWGFSIAPNTFIKPALAILTVFGALFGPVAGLLIGLI GHTVTDTIAGWSIWWGWVISSGIIGFTMGFIQKRVGFSVKNGTYNKGDISYLAITGLIGI VIAIIFAGAFDIIVMGEPFDKIVIQVLGATIADVIVFLVLGLPITIGLAKSNKKHTHLKI EK

Protein Names:Recommended name: UPF0397 protein BA_2640/GBAA_2640/BAS2460

Gene Names:Ordered Locus Names:BA_2640, GBAA_2640, BAS2460

Expression Region:1-182

Sequence Info:full length protein

View full details