Gene Bio Systems
Recombinant UPF0382 inner membrane protein ygdD(ygdD)
Recombinant UPF0382 inner membrane protein ygdD(ygdD)
SKU:CSB-CF359992EOD
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Escherichia coli O157:H7
Uniprot NO.:P0ADR4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTSRFMLIFAAISGFIFVALGAFGAHVLSKTMGAVEMGWIQTGLEYQAFHTLAILGLAVA MQRRISIWFYWSSVFLALGTVLFSGSLYCLALSHLRLWAFVTPVGGVSFLAGWALMLVGA IRLKRKGVSHE
Protein Names:Recommended name: UPF0382 inner membrane protein ygdD
Gene Names:Name:ygdD Ordered Locus Names:Z4124, ECs3667
Expression Region:1-131
Sequence Info:full length protein
