Recombinant  UPF0295 protein BA_0538-GBAA_0538-BAS0506(BA_0538, GBAA_0538, BAS0506)

Recombinant UPF0295 protein BA_0538-GBAA_0538-BAS0506(BA_0538, GBAA_0538, BAS0506)

CSB-CF772371BQE
Regular price
$1,090.00 USD
Sale price
$1,090.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus anthracis

Uniprot NO.:Q81YU3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFW IGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRDLEGKEFDEKYNKKSYKS

Protein Names:Recommended name: UPF0295 protein BA_0538/GBAA_0538/BAS0506

Gene Names:Ordered Locus Names:BA_0538, GBAA_0538, BAS0506

Expression Region:1-118

Sequence Info:full length protein