Skip to product information
1 of 1

Gene Bio Systems

Recombinant UPF0233 membrane protein Mb0011c (Mb0011c)

Recombinant UPF0233 membrane protein Mb0011c (Mb0011c)

SKU:CSB-CF302285MVH

Regular price $1,670.00 USD
Regular price Sale price $1,670.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium bovis

Uniprot NO.:P67377

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGSQA PTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH

Protein Names:Recommended name: UPF0233 membrane protein Mb0011c

Gene Names:Ordered Locus Names:Mb0011c

Expression Region:1-93

Sequence Info:full length protein

View full details