Gene Bio Systems
Recombinant UPF0208 membrane protein YPO2564-y1623-YP_2375(YPO2564, y1623, YP_2375)
Recombinant UPF0208 membrane protein YPO2564-y1623-YP_2375(YPO2564, y1623, YP_2375)
SKU:CSB-CF835288YAS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Yersinia pestis
Uniprot NO.:Q8ZDJ8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTIKPSDSVSWFQVLQRGQHYMKTWPADKRLAPVFPENRVTVVTRFGIRFMPPLAIFTLT WQIALGGQLGPAIATALFACGLPLQGLWWLGKRAITPLPPTLLQWFHEVRHKLFEAGQAV APIEPIPTYQSLADLLKRAFKQLDKTFLDDL
Protein Names:Recommended name: UPF0208 membrane protein YPO2564/y1623/YP_2375
Gene Names:Ordered Locus Names:YPO2564, y1623, YP_2375
Expression Region:1-151
Sequence Info:full length protein
