Gene Bio Systems
Recombinant UPF0197 transmembrane protein CBG19073(CBG19073)
Recombinant UPF0197 transmembrane protein CBG19073(CBG19073)
SKU:CSB-CF720231CXX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Caenorhabditis briggsae
Uniprot NO.:Q60WL8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDISKMDRYAAPVHFSSLPLLATVLCGVGLLLLAAFTMLQVTSTKYNRNVFKELFIAATS SIFLGFGSVFLLLWVGIYV
Protein Names:Recommended name: UPF0197 transmembrane protein CBG19073
Gene Names:ORF Names:CBG19073
Expression Region:1-79
Sequence Info:full length protein
