Skip to product information
1 of 1

Gene Bio Systems

Recombinant UPF0092 membrane protein YajC(yajC)

Recombinant UPF0092 membrane protein YajC(yajC)

SKU:CSB-CF365063EOD

Regular price $1,755.00 USD
Regular price Sale price $1,755.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli O157:H7

Uniprot NO.:P0ADZ9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSFFISDAVAATGAPAQGSPMSLILMLVVFGLIFYFMILRPQQKRTKEHKKLMDSIAKGD EVLTNGGLVGRVTKVAENGYIAIALNDTTEVVIKRDFVAAVLPKGTMKAL

Protein Names:Recommended name: UPF0092 membrane protein YajC

Gene Names:Name:yajC Ordered Locus Names:Z0506, ECs0458

Expression Region:1-110

Sequence Info:full length protein

View full details