Skip to product information
1 of 1

Gene Bio Systems

Recombinant UPF0060 membrane protein Rv2639c-MT2717 (Rv2639c, MT2717)

Recombinant UPF0060 membrane protein Rv2639c-MT2717 (Rv2639c, MT2717)

SKU:CSB-CF355478MVZ

Regular price $1,692.00 USD
Regular price Sale price $1,692.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium tuberculosis

Uniprot NO.:P67146

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVVRSILLFVLAAVAEIGGAWLVWQGVREQRGWLWAGLGVIALGVYGFFATLQPDAHFGR VLAAYGGVFVAGSLAWGMALDGFRPDRWDVIGALGCMAGVAVIMYAPRGH

Protein Names:Recommended name: UPF0060 membrane protein Rv2639c/MT2717

Gene Names:Ordered Locus Names:Rv2639c, MT2717 ORF Names:MTCY441.09c

Expression Region:1-110

Sequence Info:full length protein

View full details