Gene Bio Systems
Recombinant Uncharacterized protein ZK1098.9 (ZK1098.9)
Recombinant Uncharacterized protein ZK1098.9 (ZK1098.9)
SKU:CSB-CF339475CXY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Caenorhabditis elegans
Uniprot NO.:P34608
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSEKHFILPSSMLMIVSAVFGGIGIITTIVFVILTVLHSKSAVCKPAGKEDMKKLNGIEG MQTIKEECGGSTETSSSKPKKKAKKEV
Protein Names:Recommended name: Uncharacterized protein ZK1098.9
Gene Names:ORF Names:ZK1098.9
Expression Region:1-87
Sequence Info:full length protein
