Recombinant  Uncharacterized protein ybfB(ybfB)

Recombinant Uncharacterized protein ybfB(ybfB)

CSB-CF359521EOD
Regular price
$1,090.00 USD
Sale price
$1,090.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Escherichia coli O157:H7

Uniprot NO.:P0AAU6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKYIIFLFRAIWLALSLLILFFSMHRLSLLDSTRDVSELISLMSYGMMVICFPTGIVFFI ALIFIGTVSDIIGVRIDSKYIMAIIIWLYFLSGGYIQWFVLSKRIINK

Protein Names:Recommended name: Uncharacterized protein ybfB

Gene Names:Name:ybfB Ordered Locus Names:Z0849

Expression Region:1-108

Sequence Info:full length protein