Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein Rv0961-MT0989 (Rv0961, MT0989)

Recombinant Uncharacterized protein Rv0961-MT0989 (Rv0961, MT0989)

SKU:CSB-CF353788MVZ

Regular price $1,698.00 USD
Regular price Sale price $1,698.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium tuberculosis

Uniprot NO.:P64775

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRVPSQWMISSRVTVAWNIVGYLVYAALAFVGGFAVWFSLFFAMATDGCHDSACDASYHV FPAMVTMWIGVGAVLLLTLVVMVRNSSRGNVVIGWPFVGLLALGLVYVAADAVLH

Protein Names:Recommended name: Uncharacterized protein Rv0961/MT0989

Gene Names:Ordered Locus Names:Rv0961, MT0989 ORF Names:MTCY10D7.13c

Expression Region:1-115

Sequence Info:full length protein

View full details