Recombinant  Uncharacterized protein pXO2-65-BXB0087-GBAA_pXO2_0087(pXO2-65, BXB0087, GBAA_pXO2_0087)

Recombinant Uncharacterized protein pXO2-65-BXB0087-GBAA_pXO2_0087(pXO2-65, BXB0087, GBAA_pXO2_0087)

CSB-CF882671BQE
Regular price
$1,081.00 USD
Sale price
$1,081.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus anthracis

Uniprot NO.:Q9RMW9

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKIWKNILNIILALAVPIGLLFISMMIGEGVLDLFLDILNINYDDLSYLEEKAFAMFIPL LIIALTLLVTFLHHRSLRPLRLSTGFLSKETYKNYGIGIGIVFIFLSLIQS

Protein Names:Recommended name: Uncharacterized protein pXO2-65/BXB0087/GBAA_pXO2_0087

Gene Names:Ordered Locus Names:pXO2-65, BXB0087, GBAA_pXO2_0087

Expression Region:1-111

Sequence Info:full length protein