Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus anthracis
Uniprot NO.:Q9RMW9
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKIWKNILNIILALAVPIGLLFISMMIGEGVLDLFLDILNINYDDLSYLEEKAFAMFIPL LIIALTLLVTFLHHRSLRPLRLSTGFLSKETYKNYGIGIGIVFIFLSLIQS
Protein Names:Recommended name: Uncharacterized protein pXO2-65/BXB0087/GBAA_pXO2_0087
Gene Names:Ordered Locus Names:pXO2-65, BXB0087, GBAA_pXO2_0087
Expression Region:1-111
Sequence Info:full length protein