Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein pXO1-111-BXA0163-GBAA_pXO1_0163 (pXO1-111, BXA0163, GBAA_pXO1_0163)

Recombinant Uncharacterized protein pXO1-111-BXA0163-GBAA_pXO1_0163 (pXO1-111, BXA0163, GBAA_pXO1_0163)

SKU:CSB-CF319542BQE

Regular price $1,835.00 USD
Regular price Sale price $1,835.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus anthracis

Uniprot NO.:P13422

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MESLGINNIYNALDRIKLNAKMNILVRDPYHYDNNGNIVGVDDSYLKNAYKQILNWSSDG VSLNLDEDVNQALSGYMLQIKKPSNHLTNSPVTITLAGKDSGVGELYRVLSDGTGFLDFN KFDENWRSLVDPGDDVYVYAVTKEDFNAVTRDENGNIANKLKNTLVLSGKIKEINIKTTN INIFVVFMFIIYLLFYIISSTVFAKSCNCILIYVEVSQLMNSVFY

Protein Names:Recommended name: Uncharacterized protein pXO1-111/BXA0163/GBAA_pXO1_0163

Gene Names:Ordered Locus Names:pXO1-111, BXA0163, GBAA_pXO1_0163

Expression Region:1-225

Sequence Info:full length protein

View full details