Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized protein ML0614(ML0614)

Recombinant Uncharacterized protein ML0614(ML0614)

SKU:CSB-CF669856MVN

Regular price $1,671.00 USD
Regular price Sale price $1,671.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium leprae

Uniprot NO.:Q49760

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MWKARTALGDLDTVFYDAGTANGTNGISVSPVNGFLNWWDSIELWLSGLAFVLQAALVMP VVLAFAYGTALVLDFALGKGIQLMRRAYHPDSARG

Protein Names:Recommended name: Uncharacterized protein ML0614

Gene Names:Ordered Locus Names:ML0614 ORF Names:B1937_F2_47

Expression Region:1-95

Sequence Info:full length protein

View full details