Gene Bio Systems
Recombinant Uncharacterized protein in ramA 3'region
Recombinant Uncharacterized protein in ramA 3'region
SKU:CSB-CF671886KBG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Klebsiella pneumoniae
Uniprot NO.:Q48414
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKHPLETLLSAAGILLLALLSCLLLPAPSLGLTLAQKLVETFHMMDLNQLYTVLFCLWFL ALGAIEYLVLRWVWRRWFSLER
Protein Names:Recommended name: Uncharacterized protein in ramA 3'region
Gene Names:
Expression Region:1-82
Sequence Info:full length protein
