Gene Bio Systems
Recombinant Uncharacterized protein F59B10.6(F59B10.6)
Recombinant Uncharacterized protein F59B10.6(F59B10.6)
SKU:CSB-CF600293CXY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Caenorhabditis elegans
Uniprot NO.:Q09954
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MHLEVTEKHVNMESYKPAIDLLFDEVSQIFWIVLFFYVIVSMIWIMYCCYINKMELSLVE KKIEENGVARSKELQRLLDAYNKITAENPTAPNPQSSSIIIPEQV
Protein Names:Recommended name: Uncharacterized protein F59B10.6
Gene Names:ORF Names:F59B10.6
Expression Region:1-105
Sequence Info:full length protein
