Skip to product information
1 of 1

Gene Bio Systems

Recombinant Uncharacterized membrane protein yszA(yszA)

Recombinant Uncharacterized membrane protein yszA(yszA)

SKU:CSB-CF496108BRI

Regular price $1,680.00 USD
Regular price Sale price $1,680.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis

Uniprot NO.:C0H465

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKKRFSSYSLPPWVRQIRLVSAQVIIPITIFQGIRTIFFPTTFDVLLLAILIFLACALHL EWI

Protein Names:Recommended name: Uncharacterized membrane protein yszA

Gene Names:Name:yszA Ordered Locus Names:BSU28099

Expression Region:1-63

Sequence Info:full length protein

View full details