Gene Bio Systems
Recombinant Uncharacterized membrane protein ydzN(ydzN)
Recombinant Uncharacterized membrane protein ydzN(ydzN)
SKU:CSB-CF496096BRI
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus subtilis
Uniprot NO.:C0H3V7
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MRWSKWFNVFCIVALGSIYGYKLFTNQEVSTTRLIIASVIVLWNIVGLFSKESVKQAQQA N
Protein Names:Recommended name: Uncharacterized membrane protein ydzN
Gene Names:Name:ydzN Ordered Locus Names:BSU05109
Expression Region:1-61
Sequence Info:full length protein