Skip to product information
1 of 1

Gene Bio Systems

Recombinant Type IV secretion system protein ptlB homolog(ptlB)

Recombinant Type IV secretion system protein ptlB homolog(ptlB)

SKU:CSB-CF760213BIK

Regular price $1,685.00 USD
Regular price Sale price $1,685.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bordetella parapertussis

Uniprot NO.:Q7W2U4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRDPLFKGCTRPAMLMGVPATPLAVCSGTIALLGIWFSIAFLALFPVALLAMRIMIRRDD QQFRLIWLYLRMRWLSRDRTHAFWQSTVYAPLRYAERRRRLRKP

Protein Names:Recommended name: Type IV secretion system protein ptlB homolog

Gene Names:Name:ptlB Ordered Locus Names:BPP4310

Expression Region:1-104

Sequence Info:full length protein

View full details