Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Turnip yellows virus (isolate FL-1) (TuYV) (BWYV-FL1)
Uniprot NO.:P09506
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:TTAPQGRVFAQEDIAEIEGLYAQVMKRVQQAEDFKPKTGKYWGDMEDDEDIFFESKEDLS GNGVRGTVRGTNGEGSSTPKTSNVDGKEMMEKIISSLVGKINLENIERKVIEEISAKAMK TPKSRRRRAPKKQPESSKDTSPRSTTGKYQPPHVRSPASVTAANCPNTTTPSKKKNLAGG RPSSGTIPRWVRKQAASAGPSSAPKQN
Protein Names:Recommended name: Protein P1 Alternative name(s): 66.2 kDa protein Genome-linked protein precursor Protein ORF1 Cleaved into the following 2 chains: 1. Serine protease EC= 2. 3.4.21.- 3. VPg/P1-C25
Gene Names:ORF Names:ORF1
Expression Region:401-607
Sequence Info:full length protein