Skip to product information
1 of 1

Gene Bio Systems

Recombinant Tropheryma whipplei UPF0233 membrane protein TWT_010 (TWT_010)

Recombinant Tropheryma whipplei UPF0233 membrane protein TWT_010 (TWT_010)

SKU:CSB-CF302967TIW

Regular price $1,643.00 USD
Regular price Sale price $1,643.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Tropheryma whipplei (strain Twist) (Whipple's bacillus)

Uniprot NO.:P67378

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSRKKHESSENNPVWFPTIMFGLMGTGAVWMVLFYISNGALPLPAVGTWNILIAFGIIMA GFAMMSRWK

Protein Names:Recommended name: UPF0233 membrane protein TWT_010

Gene Names:Ordered Locus Names:TWT_010

Expression Region:1-69

Sequence Info:full length protein

View full details