Skip to product information
1 of 1

Gene Bio Systems

Recombinant Triticum timopheevii ATP synthase protein MI25

Recombinant Triticum timopheevii ATP synthase protein MI25

SKU:CSB-CF303898TIP

Regular price $1,793.00 USD
Regular price Sale price $1,793.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Triticum timopheevii (Timopheev's wheat) (Triticum dicoccon var. timopheevii)

Uniprot NO.:P68537

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRFLSTDMKDRNMLFAAIPSICASSPKKISIYNEEMIVARCFIGFLIFSRKSLGKTFKET LDGRIESIQEELLQFFNPNEVIPEESNEQQRLLRISLRICSTVVESLPTARCAPKCEKTV QALLCRNLNVKSATLLNATSSRRIRLQDDIVTGFHFSVSERFVSGSTFKASTIDLIREGL IVLRKVRVGGSI

Protein Names:Recommended name: ATP synthase protein MI25 Alternative name(s): ORF25

Gene Names:

Expression Region:1-192

Sequence Info:full length protein

View full details