
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: Q43723
Gene Names: N/A
Organism: Triticum aestivum (Wheat)
AA Sequence: FREQCVPGREITYESLNARREYAVRQTCGYYLSAERQKRRCCDELSKVPELCWCEVLRILMDRRVTKEGVVKGSLLQDMSRCKKLTREFIAGIVGRE
Expression Region: 25-121aa
Sequence Info: Full Length of Mature Protein
Source: E.coli
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
MW: 31.4 kDa
Alternative Name(s): ITRL-1/ITRL-3
Relevance:
Reference: "Sharp divergence between wheat and barley at loci encoding novel members of the trypsin/alpha-amylase inhibitors family." Sanchez de la Hoz P., Castagnaro A., Carbonero P. Plant Mol. Biol. 26:1231-1236(1994)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.