Skip to product information
1 of 1

Gene Bio Systems

Recombinant Triticum aestivum Glutenin, high molecular weight subunit PC237

Recombinant Triticum aestivum Glutenin, high molecular weight subunit PC237

SKU:CSB-EP355887TQN

Regular price $1,245.00 USD
Regular price Sale price $1,245.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: P02862

Gene Names: N/A

Organism: Triticum aestivum (Wheat)

AA Sequence: LVSVEHQAARLKVAKAQQLAAQLPAMCRLEGGDALSA

Expression Region: 1-37aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 30.8 kDa

Alternative Name(s):

Relevance: Glutenins are high-molecular weight seed storage proteins of wheat endosperm. Thought to be responsible for the visco-elastic property of wheat dough.

Reference: "Identification of barley and wheat cDNA clones related to the high-M-r polypeptides of wheat gluten."Forde J., Forde B.G., Fry R.P., Kreis M., Shewry P.R., Miflin B.J.FEBS Lett. 162:360-366(1983).

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details