Skip to product information
1 of 1

Gene Bio Systems

Recombinant Trichophyton verrucosum Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)

Recombinant Trichophyton verrucosum Altered inheritance of mitochondria protein 31, mitochondrial(AIM31)

SKU:CSB-CF515121TQC

Regular price $1,791.00 USD
Regular price Sale price $1,791.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Trichophyton verrucosum (strain HKI 0517)

Uniprot NO.:D4DDK2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSDKPLPSSFDDDPDFFQDNAWKKLGRRLKEEPLVPLGIGATCYALFRAYRSMKMGDSVQ VNRMFRARIYAQAFTLLAVCAGSVYYKTERDQRKQLEKAMDLKKQQAKRDAWLKELEIRE QEDKDWQSRHATIEQAAKGVEVKPFVADSAPDAAGRDASEEPAKESGDKKDGGSGGVLSA VKNLSWGSK

Protein Names:Recommended name: Altered inheritance of mitochondria protein 31, mitochondrial

Gene Names:Name:AIM31 ORF Names:TRV_05213

Expression Region:1-189

Sequence Info:full length protein

View full details